PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2306
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 596aa    MW: 65914.4 Da    PI: 7.3596
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2306genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.82.6e-2788170185
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                  rW++qe+laL+++r++m+ ++r+++ k+plWeevs+k++e g++rs+k+Ckek+en+ k++k++k+ + +++  + +t+++ +ql
  Gh_D05G2306  88 RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKYHKRTKDVRTGKS--DGKTYRFSNQL 170
                  8********************************************************************975..44568888776 PP

2trihelix101.95e-32421506187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev+aLie+r++++ ++ ++  k+plWee+s++m++ g++r++k+Ckekwen+nk++kk+k++ kkr +e+s+tcpyf+ql+a
  Gh_D05G2306 421 RWPKVEVQALIELRTRLDAKYHDNGPKGPLWEEISAAMKKLGYNRNAKRCKEKWENINKYFKKVKDNHKKR-PEDSKTCPYFHQLDA 506
                  8********************************************************************98.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.5E-485147IPR001005SANT/Myb domain
CDDcd122035.16E-2587152No hitNo description
PfamPF138372.5E-1787168No hitNo description
PROSITE profilePS500906.95787145IPR017877Myb-like domain
SMARTSM007172.7E-4418480IPR001005SANT/Myb domain
PfamPF138374.5E-22420507No hitNo description
PROSITE profilePS500907.248420478IPR017877Myb-like domain
CDDcd122031.15E-26420485No hitNo description
Gene3DG3DSA:1.10.10.601.8E-4420477IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MLGGGGDTTA SVLGSGGGGT DGNVTTTAGG GGAVSMGRSG GARDGGSSEG GGVAANNMFG  60
SNGNNNNNSG DEDRVRVDEG DRCFGGNRWP RQETLALLKI RSDMDVTFRD ASVKGPLWEE  120
VSRKLAELGY HRSAKKCKEK FENVFKYHKR TKDVRTGKSD GKTYRFSNQL LALETHPSFQ  180
SPPATAAVAA PTSPQQAQPQ ATMPAPSLPN VTVPSAAALP SLPQNIVPTN INPTPTLPSF  240
PNVSADQMSN STSSSTSSDL ELEGRRKKKR KWKGFFERLM REVVHEQEEM QKKFLEALEK  300
REQERMAREE AWRMQEMARI NRERELLAQE RSVAAAKDAA LMSLLQKLSE QKNPGQPQSN  360
PLQQPQPPVS VVAAAATPAA ALSVPAPQPP PPLVPQQPML NLEVASKSDN GDHSCTPSSS  420
RWPKVEVQAL IELRTRLDAK YHDNGPKGPL WEEISAAMKK LGYNRNAKRC KEKWENINKY  480
FKKVKDNHKK RPEDSKTCPY FHQLDALYRE KNKHDSSSTQ FKPQNSVPLM VRPEQQWPPL  540
PPSDPDHQHR RDPEDLESYQ NHQDEDGNDE YEDEDEDERG EYEIVASKPV SMGTCE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264269RRKKKR
2264270RRKKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.201780.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9637820.0JX963782.1 Gossypium hirsutum clone NBRI_TRANS-1010 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446163.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-142TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D2TVC40.0A0A0D2TVC4_G
STRINGPOPTR_0002s06920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-154Trihelix family protein